PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_010937837.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Arecales; Arecaceae; Arecoideae; Cocoseae; Elaeidinae; Elaeis
Family MYB
Protein Properties Length: 1678aa    MW: 182322 Da    PI: 6.4621
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_010937837.1genomeOGView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding21.74.6e-07765806346
                      SS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHH CS
  Myb_DNA-binding   3 rWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqk 46 
                      +WT+ E e + +  + +G++ +++I++ ++ ++t  +c+++++k
   XP_010937837.1 765 PWTQGEKEVFMEMLATFGKD-FTKISSFLN-HKTTADCIEFYYK 806
                      8*****************99.*********.***********98 PP

2Myb_DNA-binding31.64e-109741013445
                       S-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHH CS
  Myb_DNA-binding    4 WTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwq 45  
                       WT eE   +++a  ++G++ ++ I++++g +R+++qck ++ 
   XP_010937837.1  974 WTDEEKSMFIRALSMYGKD-FAMISQCVG-TRSREQCKIFFS 1013
                       *****************99.*********.********8775 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF466897.18E-14748811IPR009057Homeodomain-like
PROSITE profilePS5129314.371761812IPR017884SANT domain
SMARTSM007172.3E-7762810IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.609.0E-5764809IPR009057Homeodomain-like
PfamPF002492.0E-5765806IPR001005SANT/Myb domain
PROSITE profilePS5129313.8659691020IPR017884SANT domain
SMARTSM007172.9E-99701018IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.603.8E-69721014IPR009057Homeodomain-like
SuperFamilySSF466891.72E-119731021IPR009057Homeodomain-like
CDDcd001677.12E-89741012No hitNo description
PfamPF002492.3E-89741012IPR001005SANT/Myb domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 1678 aa     Download sequence    Send to blast
MPPEPVPWDR KDFVFKDRKH ERGAGSDALG GGSSSSTTRW REPYHGPRDF PRASPRRPPP  60
GQYRQSGGYH QLYPENSGAH GCTPSRSDRF WLEDEGFRPS SGRYGGGGGR SSSGGSRESR  120
GSFRRSPYWD SSDSSRQQHH DPPVTAQRSV AVPISPASQP PLKDQNDKTG GGVDDGSGTG  180
HRFDRDHSLG SISWKPLKWS RAGSLSSTKA GRSELEETGL EVLIPTGKET PIRSPVTSPA  240
PSDEGASKKK PRLGWGQGLA KYEKQKVEGS LDASGTAAKD ALNETSPKVV GLAGCPSPAT  300
PGSVTCSSSP AGIEEKPCVK VVNGDNDTSH YRDPAEELSI KLGHMEGNPI NILTALLADL  360
WQPDDASMGD STFSRQTAMN KLLLFKEDIS RELEKTECEI DLFENELKSL DGDPENDPHQ  420
SSFTSPANTA PEPCIESSNV ASKDSNLSKG HEFTSSAVTL VENNALPTDA CDAEIKGVDL  480
DSPQTVSSRF NNSASSRKGV CDHETEQLAE CLEIVENHRF KVSEIQHSVL SDDVERPATV  540
CDNGDGSRGE AGSSSDNGNF EASLHGRTDC NLITLIMASN RDAANKASQV FHKALLTSPP  600
QLDVWGSDKL LSYRQNDFRI KEKLAIHKQL LKFKERVLTL KFRALHHLWK EDLRLLSIRK  660
HRTKSSRRFE LSSRASQGGS QKQRCSIRSR FALPAGNLTL VPTTEIVEFT SKLLSDSQIK  720
LYRNNLKMPA LILDENGRKQ TKFITHNGLI EDPISFEKER AMINPWTQGE KEVFMEMLAT  780
FGKDFTKISS FLNHKTTADC IEFYYKNHKS ESFREVKKRL NLNKQWQRLP TSSYLGTSGK  840
KWNREVNAAS LDMLGAASVV AAHSNGNATS QQRYSGHGAH DGLKVSCGSY GSLERVSNVE  900
TPGHERETVA AGVLVGICGA LEAVSSCITS SIDPVEKMNY MAKEWPLTPE VTQNFDEDDT  960
CSDEGCGELD SADWTDEEKS MFIRALSMYG KDFAMISQCV GTRSREQCKI FFSKARKCLG  1020
LDVIHQGTSN GGMPMSDTNG GRSDTDDACA AEMDSAICST QSCSKMDADV SQSVANISSE  1080
GFVHAARTPL QAETDKSSEQ DVVGGINLEE DEGKVDKQAS VLHDDKLGSE GDNPQSMQDV  1140
DAALRCNASV QHEAVGCVDA EMKMEGSSPI VSPGEPVFTV CMEVESKSHI DGVVEKKETG  1200
GSADVLKKEV DVSLPVPETG SRNRQLMVDL GATNGGTICS TSDSKADPNA LHLGNKVDDC  1260
PRSTVAPIYP HQMPLDLLPC LQNKSQGISL MQENSHSVPS NSVLPDPSSA RFEGPLLATP  1320
QATLNFEDHG NKRHKNPVAR DLYPVDQPLH MMRNPSLKQV DQPMCILRGY PLQVLNQEVK  1380
KEADPLISEN AVFMESHPKR NGVSQSGQFF ISEMYSDHCN GSSLSHSRPG VLFPPRNEAQ  1440
PEAQLKHSSQ NSCSEPEEQA HRTGDVKLFG QIICHPSSSQ KSSSSLHECN SKPSSPQVNR  1500
SSTLKSSNGG KAGTLFASRP GSSGHGGLGE LPLRSYGLWD GSRKQAGFSS LPESAVMLAK  1560
YPGSLAGMSF YSGKDSVPSR NRILTDYQQT YMQHLSSDEK RLQSFCELQK RNGIETVSGF  1620
QQQGRVPRLG SNMVGGGILG GGGGVSDPVA ALKMHYAARA KVLSGELESW RGGDIGGR
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
4a69_D1e-15728814994NUCLEAR RECEPTOR COREPRESSOR 2
4a69_C1e-15728814994NUCLEAR RECEPTOR COREPRESSOR 2
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010937837.10.0PREDICTED: uncharacterized protein LOC105057083 isoform X1
TrEMBLM0TXE90.0M0TXE9_MUSAM; Uncharacterized protein
STRINGGSMUA_Achr9P04400_0010.0(Musa acuminata)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP62993549
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G52250.11e-128MYB family protein